Edit |   |
Antigenic Specificity | Keratin 19 (KRT19) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | KRT19 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. |
Immunogen | Cytokeratin 19 antibody was raised using the N terminal of KRT19 corresponding to a region with amino acids LEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDN |
Other Names | k19|ck19|k1cs|krt9|krt15|MGC76282|MGC83069|KRT19|CK19|K19|K1CS|GK-19|Ka19|Krt1-19|AI663979|EndoC|Krt-1.19 |
Gene, Accession # | Gene ID: 3880 |
Catalog # | ABIN631608 |
Price | |
Order / More Info | Keratin 19 (KRT19) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |