| Edit |   |
|---|
| Antigenic Specificity | Keratin 7 (KRT7) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. |
|---|
| Immunogen | Cytokeratin 7 antibody was raised using the N terminal of KRT7 corresponding to a region with amino acids SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV |
|---|
| Other Names | CK7|K2C7|K7|SCL|D15Wsu77e|Krt2-7|KRT7 |
|---|
| Gene, Accession # | Gene ID: 3855 |
|---|
| Catalog # | ABIN631503 |
|---|
| Price | |
|---|
| Order / More Info | Keratin 7 (KRT7) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|