Edit |   |
Antigenic Specificity | ZSCAN5A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-ZSCAN5A Antibody |
Immunogen | The immunogen for Anti-ZSCAN5A antibody is: synthetic peptide directed towards the middle region of human ZSCAN5A. Synthetic peptide located within the following region: GNRGDALNLSSPKRSKPDASSISQEEPQGEATPVGNRESPGQAGMNSIHS |
Other Names | n/a |
Gene, Accession # | ZSA5A, Accession: NM_024303 |
Catalog # | TA339859 |
Price | |
Order / More Info | ZSCAN5A Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |