| Edit |   |
|---|
| Antigenic Specificity | rho Guanine Nucleotide Exchange Factor (GEF) 26 (ARHGEF26) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SGEF activates RhoG GTPase by promoting the exchange of GDP by GTP. SGEF is required for the formation of membrane ruffles during macropinocytosis. SGEF is also required for the formation of cup-like structures during trans-endothelial migration of leukoc |
|---|
| Immunogen | SGEF antibody was raised using the N terminal of SGEF corresponding to a region with amino acids MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITD |
|---|
| Other Names | SGEF|AI303572|AW491953|4631416L12Rik|8430436L14Rik|RGD1562559|Sgef|CSGEF|HMFN1864 |
|---|
| Gene, Accession # | Gene ID: 26084 |
|---|
| Catalog # | ABIN632081 |
|---|
| Price | |
|---|
| Order / More Info | rho Guanine Nucleotide Exchange Factor (GEF) 26 (ARHGEF26) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|