| Edit |   |
|---|
| Antigenic Specificity | Pannexin 3 (PANX3) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mammalian |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by this gene belongs to the innexin family. Innexin family members are known to be the structural components of gap junctions. |
|---|
| Immunogen | Pannexin 3 antibody was raised using the middle region of PANX3 corresponding to a region with amino acids IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL |
|---|
| Other Names | PX3|3230401P04|4833413G11Rik |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN635645 |
|---|
| Price | |
|---|
| Order / More Info | Pannexin 3 (PANX3) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|