Edit |   |
Antigenic Specificity | Secretagogin, EF-Hand Calcium Binding Protein (SCGN) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | SCGN is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. |
Immunogen | SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids LQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDM |
Other Names | SCGN|MGC146683|CALBL|DJ501N12.8|SECRET|SEGN|setagin|zgc:100843 |
Gene, Accession # | Gene ID: 10590 |
Catalog # | ABIN631459 |
Price | |
Order / More Info | Secretagogin, EF-Hand Calcium Binding Protein (SCGN) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |