Edit |   |
Antigenic Specificity | Protein Phosphatase 1J (PPM1J) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known. |
Immunogen | PPM1 J antibody was raised using a synthetic peptide corresponding to a region with amino acids YTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS |
Other Names | 2310008J22Rik|PP2Czeta|Ppp2cz|PP2CZ|PPP2CZ |
Gene, Accession # | Gene ID: 333926,71887,295341 |
Catalog # | ABIN632793 |
Price | |
Order / More Info | Protein Phosphatase 1J (PPM1J) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |