| Edit |   |
|---|
| Antigenic Specificity | CHMP1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 98%, rat 97%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human CHMP1B polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT |
|---|
| Other Names | charged multivesicular body protein 1B, C18orf2, CHMP1.5, Vps46B |
|---|
| Gene, Accession # | Gene ID: 57132, UniProt: Q7LBR1, ENSG00000255112 |
|---|
| Catalog # | HPA062896 |
|---|
| Price | |
|---|
| Order / More Info | CHMP1B Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|