| Edit |   |
|---|
| Antigenic Specificity | ATG14L |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ATG14L Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | beclin 1-associated autophagy-related key regulator; Beclin 1-associated autophagy-related key regulator; beclin 1-associated autophagy-related key regulator; autophagy related 14; Autophagy-related protein 14-like protein, ATG14; ATG14; ATG14L; BARKOR; KIAA0831; Atg14L |
|---|
| Gene, Accession # | ATG14L, Gene ID: 22863, NCBI: NP_055739.2, UniProt: Q6ZNE5 |
|---|
| Catalog # | MBS178045 |
|---|
| Price | |
|---|
| Order / More Info | ATG14L Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Diao J; Liu R; Rong Y; Zhao M; Zhang J; Lai Y; Zhou Q; Wilz LM; Li J; Vivona S; Pfuetzner RA; Brunger AT; Zhong Q. ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes. Nature, 2015 Apr 23. |
|---|