| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PI3 Kinase p110 beta/PIK3CB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform(PIK3CB) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform is an enzyme that in humans is encoded by the PIK3CB gene. This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556-598aa DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW), different from the related mouse and rat sequences by one amino acid. |
|---|
| Other Names | Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform;PI3-kinase subunit beta;PI3K-beta;PI3Kbeta;PtdIns-3-kinase subunit beta;2.7.1.153;Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta;PtdIns-3-kinase subunit p110-beta;p110beta;PIK3CB;PIK3C1; |
|---|
| Gene, Accession # | PIK3CB, UniProt: P42338 |
|---|
| Catalog # | A01091-1 |
|---|
| Price | |
|---|
| Order / More Info | PI3 Kinase p110 beta/PIK3CB Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|