| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ITK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ITK Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ITK (575-617aa FRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAE), different from the related mouse sequence by five amino acids. |
|---|
| Other Names | tyrosine-protein kinase ITK/TSK; Tyrosine-protein kinase ITK/TSK; tyrosine-protein kinase ITK/TSK; IL2 inducible T-cell kinase; Interleukin-2-inducible T-cell kinase; IL-2-inducible T-cell kinase; Kinase EMT; T-cell-specific kinase; Tyrosine-protein kinase Lyk, ITK; ITK; EMT; LYK; LPFS1; PSCTK2; EMT; LYK; IL-2-inducible T-cell kinase |
|---|
| Gene, Accession # | ITK, Gene ID: 3702, NCBI: NP_005537.3, UniProt: Q08881 |
|---|
| Catalog # | MBS178643 |
|---|
| Price | |
|---|
| Order / More Info | ITK Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: ITK IL2-inducible T-cell kinase. 2. Gibson S, Leung B, Squire JA, Hill M, Arima N, Goss P, Hogg D, Mills GB (September 1993).Identification, cloning, and characterization of a novel human T-cell-specific tyrosine kinase located at the hematopoietin complex on chromosome 5q. Blood. 82 (5): 1561-72. 3. Gomez-Rodriguez J, Kraus ZJ, Schwartzberg PL (March 2011). Tec family kinases Itk and Rlk/Txk in T lymphocytes: cross-regulation of cytokine production and T-cell fates.. |
|---|
| 产品资料 |
|
|