Edit |   |
Antigenic Specificity | ZP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal Anti-ZP1 Antibody |
Immunogen | The immunogen for anti-ZP1 antibody: synthetic peptide directed towards the middle region of human ZP1. Synthetic peptide located within the following region: TLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDN |
Other Names | HEL163, OOMD, zona pellucida glycoprotein 1 (sperm receptor) |
Gene, Accession # | ZP1, Accession: NM_207341 |
Catalog # | TA335102 |
Price | |
Order / More Info | ZP1 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |