| Edit |   |
|---|
| Antigenic Specificity | ATF6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Immunohistochemistry (IHC), Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ATF6 Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK), different from the related mouse and rat sequences by one amino acid.Subcellular Localization: Endoplasmic reticulum membrane; Single-pass type II membrane protein.Tissue |
|---|
| Other Names | cyclic AMP-dependent transcription factor ATF-6 alpha; Cyclic AMP-dependent transcription factor ATF-6 alpha; cyclic AMP-dependent transcription factor ATF-6 alpha; activating transcription factor 6; Activating transcription factor 6 alpha; ATF6-alpha, ATF6; ATF6; ACHM7; ATF6A; cAMP-dependent transcription factor ATF-6 alpha; ATF6-alpha |
|---|
| Gene, Accession # | ATF6, Gene ID: 22926, NCBI: NP_031374.2, UniProt: P18850 |
|---|
| Catalog # | MBS1750458 |
|---|
| Price | |
|---|
| Order / More Info | ATF6 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|