| Edit |   |
|---|
| Antigenic Specificity | AADACL4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat, guinea pig, human, mouse, rabbit, horse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-AADACL4 Antibody |
|---|
| Immunogen | The immunogen for Anti-AADACL4 Antibody: synthetic peptide directed towards the N terminal of human AADACL4. Synthetic peptide located within the following region: FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG |
|---|
| Other Names | arylacetamide deacetylase-like 4 |
|---|
| Gene, Accession # | ADCL4, Accession: NM_001013630 |
|---|
| Catalog # | TA336097 |
|---|
| Price | |
|---|
| Order / More Info | AADACL4 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|