| 产品详情 |
| Edit |   |
|---|
| Product Name | Leukemia Inhibitory Factor, Recombinant, Rat |
|---|
| Description | Purity ~95% (SDS-PAGE, HPLC). Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in itsaa sequence. Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 181aa and having a molecular mass of 20kD. The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques. Source: Recombinant corresponding to mouse LIF expressed in E. coli. AA Sequence: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMT-DFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCR-LCNKYRVGHVDVP |
|---|
| Size | 10ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | Leukemia Inhibitory Factor, Recombinant, Rat (LIF, Cholinergic Differentiation Factor, CDF, DIA, Differentiation-stimulating Factor, D Factor, HILDA, Melanoma-derived LPL Inhibitor, MLPLI) |
|---|
| Gene, Accession, CAS # | SwissProt: Q3U1H5 |
|---|
| Catalog # | L2040-11C |
|---|
| Price | |
|---|
| Order / More Info | Leukemia Inhibitory Factor, Recombinant, Rat from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|