| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD272/BTLA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | 100ug |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | Flow Cytometry, IHC-P, IHC-F, ICC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for CD272/BTLA detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human;Mouse. No cross reactivity with other proteins. B- and T-lymphocyte attenuator is a protein that in humans is encoded by the BTLA gene. BTLA has also been designated as CD272 (cluster of differentiation 272). This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 and CTLA4, BTLA interacts with a B7 homolog, B7H4. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL). |
|---|
| Other Names | B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein; CD272; BTLA |
|---|
| Gene, Accession # | BTLA, UniProt: Q7Z6A9 |
|---|
| Catalog # | A03149 |
|---|
| Price | |
|---|
| Order / More Info | CD272/BTLA Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|