| Edit |   |
|---|
| Antigenic Specificity | RAR-Related Orphan Receptor A (RORA) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. |
|---|
| Immunogen | RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS |
|---|
| Other Names | ror1|ror2|ror3|rzra|nr1f1|MGC146531|NR1F1|ROR1|ROR2|ROR3|RZR-ALPHA|RZRA|RORalpha-B|gb:dq017624|rora2|9530021D13Rik|Nr1f1|nmf267|sg|staggerer|tmgc26|RORalpha1 |
|---|
| Gene, Accession # | Gene ID: 6095 |
|---|
| Catalog # | ABIN630494 |
|---|
| Price | |
|---|
| Order / More Info | RAR-Related Orphan Receptor A (RORA) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|