| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KDM5B/PLU1/Jarid1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat (predicted: bovine, canine, hamster, horse, monkey, rabbit) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Lysine-specific demethylase 5B(KDM5B) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL), identical to the related mouse and rat sequences. |
|---|
| Other Names | Lysine-specific demethylase 5B;1.14.11.-;Cancer/testis antigen 31;CT31;Histone demethylase JARID1B;Jumonji/ARID domain-containing protein 1B;PLU-1;Retinoblastoma-binding protein 2 homolog 1;RBP2-H1;KDM5B;JARID1B, PLU1, RBBP2H1; |
|---|
| Gene, Accession # | KDM5B, UniProt: Q9UGL1 |
|---|
| Catalog # | PB10073 |
|---|
| Price | |
|---|
| Order / More Info | KDM5B/PLU1/Jarid1B Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|