| Edit |   |
|---|
| Antigenic Specificity | Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. |
|---|
| Immunogen | SRD5 A2 antibody was raised using the N terminal of SRD5 2 corresponding to a region with amino acids MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
|---|
| Other Names | SRD5alpha2|SRD5A2|5ART2|S5AR 2|Srd5a2 |
|---|
| Gene, Accession # | Gene ID: 6716 |
|---|
| Catalog # | ABIN635902 |
|---|
| Price | |
|---|
| Order / More Info | Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|