| Edit |   |
|---|
| Antigenic Specificity | Karyopherin alpha 4 (Importin alpha 3) (KPNA4) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognise NLSs and dock NLS-containing proteins to the nuclear pore complex. KPNA4 shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen. |
|---|
| Immunogen | Karyopherin Alpha 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI |
|---|
| Other Names | 0335/13|CG9423|Dalpha3|Dmel\\CG9423|IMPalpha3|Imp alpha-3|KAP-ALPHA3|Kap alpha3|Kap-?3|Kapalpha3|Kpna3|alphaKap3|dKap-alpha3|dimpalpha3|imp alpha3|imp-a3|imp-alpha3|impalpha3|l(3)S033513|6|ATIMPALPHA3|IMPA-3|IMPORTIN ALPHA 3|IMPORTIN ALPHA ISOFORM 3|MODIFIER OF SNC1|T10M13.16|T10M13_16|LOC100224013|1110058D08Rik|IPOA3|QIP1|SRP3|importin|ipoa3|qip1|srp3 |
|---|
| Gene, Accession # | Gene ID: 3840,16649 |
|---|
| Catalog # | ABIN630664 |
|---|
| Price | |
|---|
| Order / More Info | Karyopherin alpha 4 (Importin alpha 3) (KPNA4) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|