| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABP1/AOC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Amiloride-sensitive amine oxidase [copper-containing](AOC1) detection. Tested with WB in Human;Rat. No cross reactivity with other proteins. This gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ABP1 (144-180aa STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR), different from the related mouse sequence by ten amino acids, and from the related rat sequence by eight amino acids. |
|---|
| Other Names | Amiloride-sensitive amine oxidase [copper-containing];DAO;Diamine oxidase;1.4.3.22 ;Amiloride-binding protein 1;Amine oxidase copper domain-containing protein 1;Histaminase;Kidney amine oxidase;KAO;AOC1;ABP1, DAO1; |
|---|
| Gene, Accession # | AOC1, UniProt: P19801 |
|---|
| Catalog # | PB10040 |
|---|
| Price | |
|---|
| Order / More Info | ABP1/AOC1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|