| Edit |   |
|---|
| Antigenic Specificity | Lipocalin 12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Lipocalin 12 antibody. Specificity: Lipocalin 12 antibody was raised against the N terminal of LCN12 |
|---|
| Immunogen | Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG |
|---|
| Other Names | lipocalin 12; Epididymal-specific lipocalin-12; epididymal-specific lipocalin-12; lipocalin 12, LCN12; LCN12 |
|---|
| Gene, Accession # | Gene ID: 286256, NCBI: AAQ81977.1 |
|---|
| Catalog # | MBS5302085 |
|---|
| Price | |
|---|
| Order / More Info | Lipocalin 12 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|