| Edit |   |
|---|
| Antigenic Specificity | Lipocalin 6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Lipocalin 6 antibody. Specificity: Lipocalin 6 antibody was raised against the middle region of LCN6 |
|---|
| Immunogen | Lipocalin 6 antibody was raised using the middle region of LCN6 corresponding to a region with amino acids LWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSR |
|---|
| Other Names | Lipocalin 6; Epididymal-specific lipocalin-6; epididymal-specific lipocalin-6; lipocalin 6; Lipocalin-5, LCN6; LCN6; LCN5; hLcn5; UNQ643; LCN5 |
|---|
| Gene, Accession # | Gene ID: 158062, NCBI: AAH62746.1 |
|---|
| Catalog # | MBS5300433 |
|---|
| Price | |
|---|
| Order / More Info | Lipocalin 6 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|