| 产品详情 |
| Edit |   |
|---|
| Product Name | CECR2, Recombinant, Human, aa430-543, GST-tag (Cat Eye Syndrome Chromosome Region, Candidate 2) |
|---|
| Description | Highly Purified (~90%). CECR2 is a bromodomain-containing protein that is part of the CERF (CECR2-containing remodeling factor) complex, which facilitates the perturbation of chromatin structure in an ATP-dependent manner. May be involved through its interaction with RPPRC in the integration of cytoskeletal network with vesicular trafficking, nucleocytosolic shuttling, transcription, chromosome remodeling and cytokinesis. Source: Recombinant protein corresponding to aa430-543 from human bromodomain CECR2, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.3kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTKDLF ELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPMDISSMEKKLNGG LYCTKEEFVNDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAMMKHFPGED Applications: Suitable for use in the study o |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | n/a |
|---|
| Gene, Accession, CAS # | Accession: NM_031413, SwissProt: Q9BXF3 |
|---|
| Catalog # | 298399 |
|---|
| Price | |
|---|
| Order / More Info | CECR2, Recombinant, Human, aa430-543, GST-tag (Cat Eye Syndrome Chromosome Region, Candidate 2) from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|