| Edit |   |
|---|
| Antigenic Specificity | DEK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-DEK Antibody |
|---|
| Immunogen | The immunogen for anti-DEK antibody: synthetic peptide directed towards the N terminal of human DEK. Synthetic peptide located within the following region: AAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEG |
|---|
| Other Names | D6S231E, DEK proto-oncogene |
|---|
| Gene, Accession # | DEK, Accession: NM_003472 |
|---|
| Catalog # | TA330034 |
|---|
| Price | |
|---|
| Order / More Info | DEK Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|