Edit |   |
Antigenic Specificity | CCNB3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 100ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-CCNB3 Antibody |
Immunogen | The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the N terminal of human CCNB3. Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP |
Other Names | cyclin B3 |
Gene, Accession # | CCNB3, Accession: NM_033671 |
Catalog # | TA345466 |
Price | |
Order / More Info | CCNB3 Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |