Edit |   |
Antigenic Specificity | FGA |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50ug |
Concentration | n/a |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit Polyclonal Anti-FGA Antibody |
Immunogen | The immunogen for anti-FGA antibody: synthetic peptide directed towards the middle region of human FGA. Synthetic peptide located within the following region: SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK |
Other Names | n/a |
Gene, Accession # | FIBA, Accession: NM_021871 |
Catalog # | TA346202 |
Price | |
Order / More Info | FGA Antibody from ORIGENE TECHNOLOGIES |
Product Specific References | n/a |