| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TMC6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMC6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMC6. This antibody reacts with human. The TMC6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TMC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YYNRTVQLRCRSSRPLLGNFVRSAWPSLRLYDLELDPTALEEEEKQSLLV KELQSLAVAQRDHMLRGMPLSLAEKRSLREKSRT |
|---|
| Other Names | epidermodysplasia verruciformis 1, Epidermodysplasia verruciformis protein 1, EVER1FLJ17776, EVIN1EV1, expressed in activated T/LAK lymphocytes, LAK-4P, Protein LAK-4, transmembrane channel-like 6, transmembrane channel-like protein 6 |
|---|
| Gene, Accession # | TMC6, Gene ID: 11322 |
|---|
| Catalog # | NBP2-13438 |
|---|
| Price | |
|---|
| Order / More Info | TMC6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|