Edit |   |
Antigenic Specificity | NEDD8 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human NEDD8 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL |
Other Names | neural precursor cell expressed, developmentally down-regulated 8, Nedd-8 |
Gene, Accession # | Gene ID: 4738, UniProt: Q15843, ENSG00000129559 |
Catalog # | HPA027583 |
Price | |
Order / More Info | NEDD8 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |