| Edit |   |
|---|
| Antigenic Specificity | KPNA2/Ipoa1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-KPNA2/Ipoa1 Picoband Antibody. Reactivity: Human No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human KPNA2 (2-46aa STNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQ), different from the related mouse sequence by three amino acids.Subcellular Localization: Cytoplasm. Nucleus.Tissue Specificity: Expressed ubiquitously. |
|---|
| Other Names | importin subunit alpha-1; Importin subunit alpha-1; importin subunit alpha-1; karyopherin subunit alpha 2; Karyopherin subunit alpha-2; RAG cohort protein 1; SRP1-alpha, KPNA2; KPNA2; QIP2; RCH1; IPOA1; SRP1alpha; SRP1-alpha; RCH1; SRP1 |
|---|
| Gene, Accession # | KPNA2, Gene ID: 3838, NCBI: NP_001307540.1, UniProt: P52292 |
|---|
| Catalog # | MBS1750714 |
|---|
| Price | |
|---|
| Order / More Info | KPNA2/Ipoa1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|