| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RPA70 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-RPA70 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR), different from the related mouse sequence by three amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | replication protein A 70 kDa DNA-binding subunit; Replication protein A 70 kDa DNA-binding subunit; replication protein A 70 kDa DNA-binding subunit; replication protein A1; Replication factor A protein 1; RF-A protein 1, RPA1; RPA1; HSSB; RF-A; RP-A; REPA1; RPA70; MST075; REPA1; RPA70; RP-A p70; RF-A protein 1 |
|---|
| Gene, Accession # | RPA70, Gene ID: 6117, NCBI: NP_002936.1, UniProt: P27694 |
|---|
| Catalog # | MBS177992 |
|---|
| Price | |
|---|
| Order / More Info | RPA70 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Erdile, L. F., Heyer, W.-D., Kolodner, R., Kelly, T. J. Characterization of a cDNA encoding the 70-kDa single-stranded DNA-binding subunit of human replication protein A and the role of the protein in DNA replication. J. Biol. Chem. 266: 12090-12098, 1991. Note: Erratum: J. Biol. Chem. 268: 2268 only, 1993. 2. Haring, S. J., Mason, A. C., Binz, S. K., Wold, M. S. Cellular functions of human RPA1: multiple roles of domains in replication, repair, and checkpoints. J. Biol. Chem. 283: 19095-1911 |
|---|
| 产品资料 |
|
|