| Edit |   |
|---|
| Antigenic Specificity | CKLF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CKLF antibody. Specificity: CKLF antibody was raised against the N terminal of CKLF |
|---|
| Immunogen | CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG |
|---|
| Other Names | chemokine-like factor isoform e; Chemokine-like factor; chemokine-like factor; chemokine-like factor; C32, CKLF; CKLF; C32; CKLF1; CKLF2; CKLF3; CKLF4; UCK-1; HSPC224; CKLF1 |
|---|
| Gene, Accession # | CKLF, Gene ID: 51192, NCBI: NP_001035228.1 |
|---|
| Catalog # | MBS5300977 |
|---|
| Price | |
|---|
| Order / More Info | CKLF Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|