| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FABP4 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | mouse, rat predicted to work with: human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-FABP4 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
|---|
| Other Names | fatty acid-binding protein, adipocyte; Fatty acid-binding protein, adipocyte; fatty acid-binding protein, adipocyte; fatty acid binding protein 4; Adipocyte lipid-binding protein; ALBP; Adipocyte-type fatty acid-binding protein; A-FABP; AFABP; Fatty acid-binding protein 4, FABP4; FABP4; aP2; ALBP; AFABP; A-FABP; HEL-S-104; ALBP; A-FABP; AFABP |
|---|
| Gene, Accession # | FABP4, Gene ID: 2167, NCBI: NP_001433.1, UniProt: P15090 |
|---|
| Catalog # | MBS178211 |
|---|
| Price | |
|---|
| Order / More Info | FABP4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Hotamisligil, G. S.; Johnson, R. S.; Distel, R. J.; Ellis, R.; Papaioannou, V. E.; Spiegelman, B. M. : Uncoupling of obesity from insulin resistance through a targeted mutation in aP2, the adipocyte fatty acid binding protein. Science 274: 1377-1379, 1996. 2. Furuhashi, M.; Tuncman, G.; Gorgun, C. Z.; Makowski, L.; Atsumi, G.; Vaillancourt, E.; Kono, K.; Babaev, V. R.; Fazio, S.; Linton, M. F.; Sulsky, R.; Robl, J. A.; Parker, R. A.; Hotamisligil, G. S. : Treatment of diabetes and atheroscler |
|---|
| 产品资料 |
|
|