| Edit |   |
|---|
| Antigenic Specificity | Cobl-Like 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Cobl-Like 1 antibody. Specificity: Cobl-Like 1 antibody was raised against the middle region of COBLL1 |
|---|
| Immunogen | Cobl-Like 1 antibody was raised using the middle region of COBLL1 corresponding to a region with amino acids QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLP |
|---|
| Other Names | cordon-bleu protein-like 1 isoform 1; Cordon-bleu protein-like 1; cordon-bleu protein-like 1; cordon-bleu WH2 repeat protein-like 1, COBLL1; COBLL1; COBLR1; KIAA0977 |
|---|
| Gene, Accession # | Gene ID: 22837, NCBI: NP_001265387.1 |
|---|
| Catalog # | MBS839414 |
|---|
| Price | |
|---|
| Order / More Info | Cobl-Like 1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|