| 产品详情 |
| Edit |   |
|---|
| Product Name | TNFSF14, Recombinant, Human |
|---|
| Description | Purity ≥95% by SDS-PAGE gel and HPLC analyses. Endotoxin:≤0.1ng/ug of protein (<1EU/ug). LIGHT belongs to the TNF family of ligands, and can signal through the herpes virus entry mediator type A receptor (HVEM, TNFRSF14), LT beta R, or bind to a decoy receptor, DcR3. It is expressed in splenocytes, activated PBL, CD+8 tumor infiltrating lymphocytes, granulocytes, and monocytes. LIGHT has the ability to active NFkappaB, to co-stimulate the activation of lymphocytes and to induce apoptosis in certain human tumor cells. Recombinant human LIGHT has a calculated mass of 19.3kD containing 177aa residues. Due to glycosylation LIGHT migrates between 20-22.5kD by SDS-PAGE under non-reducing conditions. Biological Activity: Determined by its cytotoxic effect on HT-29 cells (human colon adenocarcinoma cells) in the presence of human IFN-gamma. Amino Acid Sequence: RLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRV |
|---|
| Size | 3ug, 15ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | TNFSF14, Recombinant, Human (Tumor Necrosis Factor Ligand Superfamily Member 14, CD258, Herpes Virus Entry Mediator Ligand, Herpes virus Entry Mediator Ligand, HVEML, HVEM-L, LIGHT, LTg, TR2, UNQ391/PRO726) |
|---|
| Gene, Accession, CAS # | n/a |
|---|
| Catalog # | 143425 |
|---|
| Price | |
|---|
| Order / More Info | TNFSF14, Recombinant, Human from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|