Edit |   |
Antigenic Specificity | COX8C |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 40%, rat 35%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human COX8C polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAE |
Other Names | cytochrome c oxidase subunit VIIIC, COX8-3 |
Gene, Accession # | Gene ID: 341947, UniProt: Q7Z4L0, ENSG00000187581 |
Catalog # | HPA003127 |
Price | |
Order / More Info | COX8C Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |