| Edit |   |
| Antigenic Specificity | Nucleobindin 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 0.1 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Nucleobindin 2 antibody. Specificity: Nucleobindin 2 antibody was raised against the middle region of NUCB2 |
| Immunogen | Nucleobindin 2 antibody was raised using the middle region of NUCB2 corresponding to a region with amino acids MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
| Other Names | nucleobindin-2; Nucleobindin-2; nucleobindin-2; nucleobindin 2; DNA-binding protein NEFA; Gastric cancer antigen Zg4; Prepronesfatin, NUCB2; NUCB2; NEFA; HEL-S-109; NEFA |
| Gene, Accession # | Gene ID: 4925, NCBI: NP_005004.1 |
| Catalog # | MBS5300839 |
| Price | |
| Order / More Info | Nucleobindin 2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |