Edit |   |
Antigenic Specificity | APOC4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 69%, rat 69%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human APOC4 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG |
Other Names | apolipoprotein C-IV |
Gene, Accession # | Gene ID: 346, UniProt: P55056, ENSG00000267467 |
Catalog # | HPA062671 |
Price | |
Order / More Info | APOC4 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |