Edit |   |
Antigenic Specificity | FAM133B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human FAM133B polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: AMARSRGPIQSSGPTIQDYLNRPRPTWEEV |
Other Names | family with sequence similarity 133, member B, MGC40405 |
Gene, Accession # | Gene ID: 257415, UniProt: Q5BKY9, ENSG00000234545 |
Catalog # | HPA069513 |
Price | |
Order / More Info | FAM133B Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |