Edit |   |
Antigenic Specificity | NCBP2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 98%, rat 98%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human NCBP2 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLS |
Other Names | nuclear cap binding protein subunit 2, 20kDa, Cbc2, CBP20, NIP1 |
Gene, Accession # | Gene ID: 22916, UniProt: P52298, ENSG00000114503 |
Catalog # | HPA044850 |
Price | |
Order / More Info | NCBP2 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |