| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MMP3 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-MMP3 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | stromelysin-1 preproprotein; Stromelysin-1; stromelysin-1; matrix metallopeptidase 3; Matrix metalloproteinase-3; MMP-3; Transin-1, MMP3; MMP3; SL-1; STMY; STR1; CHDS6; MMP-3; STMY1; STMY1; SL-1; MMP-3 |
|---|
| Gene, Accession # | MMP3, Gene ID: 4314, NCBI: NP_002413.1, UniProt: P08254 |
|---|
| Catalog # | MBS177674 |
|---|
| Price | |
|---|
| Order / More Info | MMP3 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: MMP3 matrix metallopeptidase 3 (stromelysin 1, progelatinase) 2. Lu, P. C.-S., Ye, H., Maeda, M., Azar, D. T. Immunolocalization and gene expression of matrilysin during corneal wound healing. Invest. Ophthal. Vis. Sci. 40: 20-27, 1999. 3. Ye S, Eriksson P, Hamsten A, Kurkinen M, Humphries SE, Henney AM (May 1996). Progression of coronary atherosclerosis is associated with a common genetic variant of the human stromelysin-1 promoter which results in reduced gene expression. J. |
|---|
| 产品资料 |
|
|