| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DR4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-DR4 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL). |
|---|
| Other Names | tumor necrosis factor receptor superfamily member 10A; Tumor necrosis factor receptor superfamily member 10A; tumor necrosis factor receptor superfamily member 10A; TNF receptor superfamily member 10a; Death receptor 4; TNF-related apoptosis-inducing ligand receptor 1; TRAIL receptor 1; TRAIL-R1; CD_antigen: CD261, TNFRSF10A; TNFRSF10A; DR4; APO2; CD261; TRAILR1; TRAILR-1; APO2; DR4; TRAILR1; TRAIL receptor 1; TRAIL-R1 |
|---|
| Gene, Accession # | TNFRSF10A, Gene ID: 8797, NCBI: NP_003835.3, UniProt: O00220 |
|---|
| Catalog # | MBS178662 |
|---|
| Price | |
|---|
| Order / More Info | DR4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Walczak H, Degli-Esposti MA, Johnson RS, Smolak PJ, Waugh JY, Boiani N, Timour MS, Gerhart MJ, Schooley KA, Smith CA, Goodwin RG, Rauch CT (Dec 1997). TRAIL-R2: a novel apoptosis-mediating receptor for TRAIL. EMBO J. 16 (17): 5386-97. 2. Pan G, O'Rourke K, Chinnaiyan AM, Gentz R, Ebner R, Ni J, Dixit VM (April 1997). The receptor for the cytotoxic ligand TRAIL. Science. 276 (5309): 111-3. |
|---|
| 产品资料 |
|
|